PTM Viewer PTM Viewer

AT4G25380.1

Arabidopsis thaliana [ath]

stress-associated protein 10

No PTMs currently found

PLAZA: AT4G25380
Gene Family: HOM05D000357
Other Names: AtSAP10,Arabidopsis thaliana ; SAP10

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 130

MVNETEALPCEGGCGLYGTRVNNNLCSLCYKKSVLQHSPALRFEPETEQSQCCPPTNSPAVEEEPVKKRRCGICKRKVGMLGFKCRCGHMFCGSHRYPEEHSCPFDYKQSGRLALATQLPLIRADKLQRF

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000058 65 111
IPR002653 4 38
Sites
Show Type Position
Active Site 10
Active Site 14
Active Site 26
Active Site 29
Active Site 71
Active Site 74
Active Site 92
Active Site 95
Active Site 85
Active Site 87
Active Site 101
Active Site 103

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here